Protein (locus-tag) | Identification | MW (kDa) | pI | Protein function | Nature of protein | Peptide signal sequence | Nature of analyzed samples | DT | Clinical significance | Reference(s) |
---|---|---|---|---|---|---|---|---|---|---|
CBU_0952 | Acute disease antigen A (adaA) | 25.9 | 8.67 | Unknown | Membrane | MKKLTVTFLTFISIFFAATAAFA | Cb isolates | BT, IP | Marker of acute Q fever | |
CBU_0612 | Putative outer membrane chaperone protein (ompH, Skp) | 18.8 | 9.71 | Molecular chaperone, interacts with unfolded proteins | Membrane* | MIKRLLSAICLSVAMIWSVAAVAQTVGLVD | Patient sera, Cb NM II TPE | IP, RP | Marker of Q fever endocarditis, SP with Q fever patients (general) | |
CBU_0937 | Hypothetical protein | 51.4 | 8.99 | Unknown | Membrane | MTSKLVISALGLCVSGALSTTLAST | mAbs, Cb NM II TPE, RP-based ELISA/HS | IP, BT | Marker of Q fever endocarditis. Marker of phase II | |
CBU_1910 | Outer membrane protein (com1) | 27.6 | 9.08 | Protein disulfide oxidoreductase, unknown role in pathogenesis | Membrane | MKNRLTALFLAGTLTAGVAIAAPSQF | mAbs, Cb NM II TPE | IP, BT, RP | SP with both acute Q fever and Q fever endocarditis. Marker of both phase I and phase II | |
CBU_0236 | Elongation factor Tu (tuf-2) | 43.5 | 5.32 | GTP-dependent binding of aminoacyl-tRNA in protein biosynthesis | Soluble*†|  | mAbs, TPE Cb NM II, HS, AS (infected/vaccinated guinea pigs) | IP | SP, marker of acute Q fever | |
CBU_0092 | Tol-pal system protein (YbgF) | 34.3 | 6.46 | Critical for maintaining integrity of bacterial outer membrane Involved in protein-protein interactions | Membrane | MRLIKMKIKTLCVSSALAALMLSAPLTWADA | TPE Cb NM I and II HS Q-fever (general), AS (immunized guinea pigs) protein microarray | IP, RP | Phase II-specific marker (early diagnosis of acute Q fever), marker of Q fever (general) | |
CBU_0311 | Outer membrane porin (Coxiella porin P1) | 26.8 | 8.44 | Able to form pore in lipid bilayers | Membrane*†OM location shown for Cb NM I | METTTKLAIGVSALCCLASAAFAGGPD | ELISA and ELISPOT based on RP/AS IP: HS, and AS (infected/vaccinated guinea pigs) | RP, IP | Marker of Q fever (general), marker of acute Q fever; applications for drug and vaccine development | |
CBU_1718 | Chaperonin (GroL) | 58.284 | 5.14 | Protein folding, ATP hydrolysis | Soluble†|  | HS/TPE Cb NM II/RP; IP HS, and AS (infected/vaccinated guinea pigs) | IP, RP | Marker of Q fever (general), marker of acute Q fever | |
CBU_0229 | 50S ribosomal protein L7/L12 (RplJ) | 13.2 | 4.71 | Binding site for several factors in protein synthesis | Membrane†| MAQLSKDDILEAVANMSVMDVVDLVKAMEEKFGVSAQAAIAVAGPVAGGEA | IP: HS, and AS (infected/vaccinated guinea pigs) | BT, IP | Marker of both phase I and phase II, marker of acute Q fever | |
CBU_0263 | DNA-directed RNA polymerase subunit alpha (rpoA) | 35.5 | 5.61 | DNA-dependent RNA polymerase transcription | Soluble | Â | OMP fraction of Cb NM II and CbuG_Q212 II; Phase 1 HS (chronic ) | IP | Marker of chronic Q fever | |
CBU_1916 | Universal stress protein family | 15.78 | 6.58 | Stress response | Soluble* | Â | OMP fraction of Cb NM II and CbuG_Q212 II; Phase 1 HS (chronic) | IP | Marker of chronic Q fever |